GenomeNet

>bsu:BSU32620 no KO assigned | (RefSeq) yurQ; hypothetical protein (A)
MIKIDIPAPNVTITERQQSANDNEPKIKPIHGFIDFHQIPRDKGGIFMFYNIHDELLFVG
KARKLRQRIKKHFEDTVSPIKHHRDEVYKIEVCVVDDPMEREIYETYIINTQHSKYNIDK
VFFK

BLAST