GenomeNet

>bsu:BSU32810 K00537 arsenate reductase (glutaredoxin) [EC:1.20.4.1] | (RefSeq) yusI; hypothetical protein (A)
MSLTFYWYPKCGTCRKAKKWLEEHGKEINEIHIAEQPPSKEELKALYEKSGLDLKKFFNT
SGMKYRELNLKEKLYHMSEDEQLELLASDGMLIKRPLTTDGEKVTVGFKEDQFEENWA

BLAST