GenomeNet

>bsu:BSU32940 K02013 iron complex transport system ATP-binding protein [EC:7.2.2.-] | (RefSeq) yusV; siderophore transport system ATP-binding protein YusV (A)
MGMSAISTETLSLGYGDAVIIDELNLTIPKGEITVFIGSNGCGKSTLLRSLARLMKPRGG
SVLLEGRAIAKLPTKEVAKELAILPQGPSAPEGLTVHQLVKQGRYPYQNWLKQWSKEDEE
AVERALKATKLEDMADRAVDSLSGGQRQRAWIAMTLAQETDIILLDEPTTYLDMTHQIEI
LDLLFELNEKEDRTIVMVLHDLNLACRYAHHLVAIKDKRIYAEGRPEEVITCDLVQNVFS
MNCQVTQDPLFGTPLCIPHGRGRCIVQEAAFTSHG

BLAST