GenomeNet

>bsu:BSU33020 K07650 two-component system, OmpR family, sensor histidine kinase CssS [EC:2.7.13.3] | (RefSeq) cssS; sensor histidine kinase (A)
MKNKPLAFQIWVVISGILLAISILLLVLFSNTLRDFFTNETYTTIENEQHVLTEYRLPGS
IERRYYSEEATAPTTVRSVQHVLLPENEEASSDKDLSILSSSFIHKVYKLADKQEAKKKR
YSADVNGEKVFFVIKKGLSVNGQSAMMLSYALDSYRDDLAYTLFKQLLFIIAVVILLSWI
PAIWLAKYLSRPLVSFEKHVKRISEQDWDDPVKVDRKDEIGKLGHTIEEMRQKLVQKDET
ERTLLQNISHDLKTPVMVIRGYTQSIKDGIFPKGDLENTVDVIECEALKLEKKIKDLLYL
TKLDYLAKQKVQHDMFSIVEVTEEVIERLKWARKELSWEIDVEEDILMPGDPEQWNKLLE
NILENQIRYAETKIEISMKQDDRNIVITIKNDGPHIEDEMLSSLYEPFNKGKKGEFGIGL
SIVKRILTLHKASISIENDKTGVTYRIAVPK

BLAST