GenomeNet

>bsu:BSU33110 K11621 lia operon protein LiaG | (RefSeq) liaG; protein LiaG (A)
MKKMLGKLLITAGILVFFAVVVKDVFAAGLGFINGTEADSASASPRDIDSMVIESDSKDV
RIIAEERSDISAGISGDSGKLFVTENKRKLELTVKEKEFQFLNGFNRSTLIVRLPYDYKG
DLAVRTSSGDVSVAGNDHLALSGLNAVSASGNTSVTDVRIQDLKVKASSGDVSISNTVSK
TAGIDLASGDANLVHVSGSLDVKMTSGDFNAVLKKVTGPVSVTLTSGDANVSLPQNGSFA
VNALSASGDVSSPYSFADKGHKEQHHITGTQGSGRHPIDIKTDSGDLAIR

BLAST