GenomeNet

>bsu:BSU33270 K02003 putative ABC transport system ATP-binding protein | (RefSeq) yvrO; ABC transporter ATP-binding protein (A)
MLTLNNISKSYKLGKEEVPILKHINLTVQAGEFLAIMGPSGSGKSTLMNIIGCLDRPTSG
TYTLDQIDILKGKDGALAEIRNESIGFVFQTFHLLPRLTALQNVELPMIYNKVKKKERRQ
RAYEALEKVGLKDRVSYKPPKLSGGQKQRVAIARALVNQPRFILADEPTGALDTKSSEQI
LALFSELHREGKTIIMITHDPDVAKKADRTVFIRDGELVLDERGDISHA

BLAST