GenomeNet

>bsu:BSU33310 K25288 ferric hydroxamate/heme transport system permease protein | (RefSeq) fhuB; iron(3+)-hydroxamate import system permease protein FhuB (A)
MHFHFCSKHSIKSAEKSDILKQQLIIIISNRKEVRQLSQHKNIRTASEEIQWTSRTYGAV
IVLIAGLCLLCLGAFLSISLGAADIHLRTVWEAIFHYQPTKTSHQIIHDLRLPRTAAAAL
VGALLAVSGAIMQGMTRNPLAEPSIMGVTSGSAFAVSIAFAFFPGLSAMGLVLWSFAGAG
LGASTVMGIGMFSRGGLTPVKLALAGTAVTYFFTGISTAIAIRFDVAQDISFWYAGGVAG
VKWSGVQLLLIAGAVGLTLAFFIARSVTVLSLGDDLAKGLGQYTSAVKLVGMLIVVILTG
AAVSIAGTIAFIGLIIPHITRFLVGVDYRWIIPCSAVLGAVLLVFADIAARLVNAPFETP
VGALTSLIGVPFFFYLARRERRGL

BLAST