GenomeNet

>bsu:BSU33750 no KO assigned | (RefSeq) sdpA; sporulation-delaying protein SdpA (A)
MTICFLLFSSYYFSNISPQNPLFKKNFLQQLSPQGFGFYSKSPTEENISFHTKENLKLPN
ALPNNFFGIKREGRVQAIELGKIVENIDPKNWKTCENNNSCTNLEKQIKPIKVIKNEDYI
HLSKGEYLIYRQKPLSWYWIDFKQTTSFERKVLKIKIV

BLAST