GenomeNet

>bsu:BSU33760 no KO assigned | (RefSeq) sdpB; sporulation-delaying protein SdpB (A)
MKILNSLEGYIDTYNPWKNTYALFRSLLGFSTLLVLLFNSTDILFSYSANNVTCENVYIP
TAFCFAKEYSINFEIIRYLMIFILTLVVIGWRPRFTGLFHWYICYSIQTSALTIDGGEQI
ATVLSFLILPVTLLDSRRNHWNIKKNNNESFTKKTVLFYIMTIIKIQVFIIYLNAALERL
KNKEWAEGTAIYYFFSDPVFGLPEYQLNLMNPLLESNFIVVITWLVTIFELFLAASIISN
IRIKRIALVLGILFHIGIIFSIGIVSFGLIMISALIIYLHPVQQNITMNWCSPLFKYIYV
KGKRNFKRIGGESVKFLTKLFHS

BLAST