GenomeNet

>bsu:BSU33850 K05595 multiple antibiotic resistance protein | (RefSeq) yvbG; hypothetical protein (A)
MMFSFIVHVFISLFAVSNPIGNVPIFLTLTEGYTAAERKAIARKAAILSFFILAAFLVFG
HLIFKLFDINIHALRVAGGIFIFGIAYNLLNAKESHVQSLHHDEHKESKEKADISVTPLS
IPIIAGPGTIATVMSLSAGHSGIGHYAAVMIGIAAVIALTFLFFHYSAFISSKLGKTEMN
VITRLMGLILAVVAVGMIGAGLKGMFPVLTS

BLAST