GenomeNet

>bsu:BSU34360 K00903 protein-tyrosine kinase [EC:2.7.10.2] | (RefSeq) epsB; tyrosine-protein kinase YveL (A)
MIFRKKKARRGLAQISVLHNKSVVAEQYRTIRTNIEFSSVQTNLRSILVTSSVPGEGKSF
SAANLAAVFAQQQEKKVLLVDADLRKPTINQTFQVDNVTGLTNVLVGNASLSETVQKTPI
DNLYVLTSGPTPPNPAELLSSKAMGDLISEIYEQFSLVIFDSPPLLAVADAQILANQTDG
SVLVVLSGKTKTDTVLKAKDALEQSNAKLLGALLNKKKMKKSEHYSY

BLAST