GenomeNet

>bsu:BSU35130 no KO assigned | (RefSeq) yvlA; hypothetical protein (A)
MNRNQAIIASLCYFSVFIAPIIVPIVAYFVVNEKETKRHAIRSLISHIVPFVGWLFLFIA
LLGGAVAIDGDSLLPVFVIIGGAVIYFLVVIGIIIWNVIQGIKVLRAA

BLAST