GenomeNet

>bsu:BSU35400 K02397 flagellar hook-associated protein 3 FlgL | (RefSeq) flgL; flagellar hook-associated protein 3 (A)
MRVTQGMIQQNSLRYIGSSYSKLDKLQSQISSGKKISKASDDPVVAMKSLKYNTQLSQVQ
QYKSNASQAFTWLENTETNITEGIDILSKVRELAVEAQNDTNGEPERQAIGVEVKQLKEQ
LLNIANTQVNGRYIFNGTNSDKPPVTDNGDGTYTISDTADVVVNISNNMSLKVNSDPKSA
FGGTSESGQNVFEMLDSFEKALNSGSLDGMDSVLNDIDHFSDGMSAERSDLGARYNRLEL
VNTRLSAQEETATKVLSDNEDVELEEVITEFIAQQSVHRATLAVNAQIVQPTLIDFLK

BLAST