GenomeNet

>bsu:BSU35440 no KO assigned | (RefSeq) yvyF; hypothetical protein (A)
MGELANCPKCNALFLKTKLQTVCQACIKEEEKSFETVYKFLRKQENRQSTLSRITEETGV
EEELILKFIRQKRIQITHLPNLAYPCERCGTSIREGKFCKACQSDIKDQMDHLNHEDALK
IEKENSKKDTYYAYNTKNS

BLAST