GenomeNet

>bsu:BSU35870 no KO assigned | (RefSeq) pgsE; hypothetical protein (A)
MKFVKAIWPFVAVAIVFMFMSAFKFNDQLTDQEKQKIDMEMNKIQQQEEPVNANK

BLAST