GenomeNet

>bsu:BSU36140 no KO assigned | (RefSeq) ywqO; hypothetical protein (A)
MKFLLSVIAGLLILALYLFWKVQPPVWIQVETNSSQLKQSVRMAGTTLQVKHMIKSDAGE
ETAVISNGISGLK

BLAST