GenomeNet

>bsu:BSU36210 no KO assigned | (RefSeq) ywqH; hypothetical protein (A)
MGYESMLADIKSSLNGKISDVEDKIEKLKKAKKDIDTLQEEAITEIKEIVKPELGKHWTG
TKADDFDKGREEAKSEASKIVNDKYNEYMASINGKIFDLEWDKAKYASELFIANGAADLL
KKGEEFAEEVGNTISKLKWW

BLAST