GenomeNet

>bsu:BSU36240 K01104 protein-tyrosine phosphatase [EC:3.1.3.48] | (RefSeq) ywqE; tyrosine-protein phosphatase YwqE (A)
MIDIHCHILPAMDDGAGDSADSIEMARAAVRQGIRTIIATPHHNNGVYKNEPAAVREAAD
QLNKRLIKEDIPLHVLPGQEIRIYGEVEQDLAKRQLLSLNDTKYILIEFPFDHVPRYAEQ
LFYDLQLKGYIPVIAHPERNREIRENPSLLYHLVEKGAASQITSGSLAGIFGKQLKAFSL
RLVEANLIHFVASDAHNVKTRNFHTQEALYVLEKEFGSELPYMLTENAELLLRNQTIFRQ
PPQPVKRRKLFGFF

BLAST