GenomeNet

>bsu:BSU36260 no KO assigned | (RefSeq) ywqC; capsular polysaccharide biosynthesis protein YwqC (A)
MGESTSLKEILSTLTKRILLIMIVTAAATAAGGLISFFALTPIYENSTQILVNQSKNERK
EVQFNDVQTNLQLINTYNVIIKSPAILDEVIKEMGLSMTSQELNDKITVSSEQDSQVVNI
SVRDENAETAAHIANTIASVFQDKITSIMNVDNVSILSKAEVSEHPSPVSPKPLLNIAIA
FAAGLAGSIGLAFLLEHLDNTIKSEEQLESLLDIPVLGTVSTIANEQKTAKTLQGFQSEK
TGSGHFGA

BLAST