GenomeNet

>bsu:BSU36640 K01428 urease subunit alpha [EC:3.5.1.5] | (RefSeq) ureC; urease subunit alpha (A)
MKMSREEYAELFGPTTGDKIRLGDTDLWIEVEKDFTVYGEEMIFGGGKTIRDGMGQNGRI
TGKDGALDLVITNVVLLDYTGIVKADVGVKDGRIVGVGKSGNPDIMDGVDPHMVIGAGTE
VISGEGKILTAGGVDTHIHFICPQQMEVALSSGVTTLLGGGTGPATGSKATTCTSGAWYM
ARMLEAAEEFPINVGFLGKGNASDKAPLIEQVEAGAIGLKLHEDWGTTPSAIKTCMEVVD
EADIQVAIHTDTINEAGFLENTLDAIGDRVIHTYHIEGAGGGHAPDIMKLASYANILPSS
TTPTIPYTVNTMDEHLDMMMVCHHLDAKVPEDVAFSHSRIRAATIAAEDILHDIGAISMT
SSDSQAMGRVGEVIIRTWQVADKMKKQRGALAGENGNDNVRAKRYIAKYTINPAITHGLS
HEVGSVEKGKLADLVLWDPVFFGVKPELVLKGGMIARAQMGDPNASIPTPEPVFMRQMYA
SYGKANRSTSITFMSQASIERGVAESLGLEKRISPVKNIRKLSKLDMKLNSALPKIEIDP
KTYQVFADGEELSCQPVDYVPLGQRYFLF

BLAST