GenomeNet

>bsu:BSU36670 no KO assigned | (RefSeq) csbD; stress response protein CsbD (A)
MGNDSVKDKMKGGFNKAKGEVKDKVGDMADRTDMQAEGKKDKAKGEIQKDIGKAKDKFSD
KD

BLAST