GenomeNet

>bsu:BSU36750 K06381 stage II sporulation protein D | (RefSeq) spoIID; stage II sporulation protein D (A)
MKQFAITLSVLCALILLVPTLLVIPFQHNKEAGASVESEKTAVSTKPASKGAETLKASPV
SIPVYRTANQSVENIPLEEYVIGVVASEMPATFKPEALKAQALAARTFIVRLMVSNSAVE
APKGSLVDDTQMFQVYKSKAELKKQWGTSYETKLKKITDAVASTQGKILTYNNQPIEASF
FSTSNGYTENAEAYWTSAIPYLKSVKSPWDKKSPKYKATKTFTAAEFQQKLGVKLDGSSA
VGKITGETPGHQVATAVINGKTLKGRDIREKLGLNSADFEWKRNGDTITVTTRGFGHGVG
MSQYGANFMAKEGKTVDDIVKYYYQGTQISEADAFLNKYMAKK

BLAST