GenomeNet

>bsu:BSU37380 no KO assigned | (RefSeq) albB; antilisterial bacteriocin subtilosin biosynthesis protein AlbB (A)
MSPAQRRILLYILSFIFVIGAVVYFVKSDYLFTLIFIAIAILFGMRARKADSR

BLAST