GenomeNet

>bsu:BSU37430 no KO assigned | (RefSeq) albG; antilisterial bacteriocin subtilosin biosynthesis protein AlbG (A)
MKQSTVFTLLLLLIGMAAYSFGWVQAVAEAAAQYVQMINNDAVRLGLLACTAALLMLPAF
LYLHYVTQSVKNMTAAFQKLTQSHQSCCDFQQHNLCSRYAEDVKSLRDSYKNVRQTYVMA
AVLCQVIIFGCMFEIVKAVPFRLHTPPAFSMGLAMLLILYLLFCMRTYLRQLFRHGSLFR
KVFAGALAAAGIWWMLSFSISELLFLIILAAIQQIGSFIYKRFSYHSTASLDL

BLAST