GenomeNet

>bsu:BSU37590 K09388 uncharacterized protein | (RefSeq) ywgA; hypothetical protein (A)
MLKEHAKLMKVFSDSGEIIGRKKLQKMIYIAKKMQFPFYEKYDFHFYGPYSEELTLQIEE
LCNLGFLHEVKEKKGGYFQYRYSLTETGSAFLDHADLDMPDMKGYIDSVNSRSSRFLELV
STILYFDGLEDEEKKEKVFTIKSKQKYTNEEYDEALQYIEELKQIC

BLAST