GenomeNet

>bsu:BSU37910 no KO assigned | (RefSeq) spsA; spore coat polysaccharide biosynthesis protein SpsA (A)
MPKVSVIMTSYNKSDYVAKSISSILSQTFSDFELFIMDDNSNEETLNVIRPFLNDNRVRF
YQSDISGVKERTEKTRYAALINQAIEMAEGEYITYATDDNIYMPDRLLKMVRELDTHPEK
AVIYSASKTYHLNENRDIVKETVRPAAQVTWNAPCAIDHCSVMHRYSVLEKVKEKFGSYW
DESPAFYRIGDARFFWRVNHFYPFYPLDEELDLNYITDQSIHFQLFELEKNEFVRNLPPQ
RNCRELRESLKKLGMG

BLAST