GenomeNet

>bsu:BSU38370 K01759 lactoylglutathione lyase [EC:4.4.1.5] | (RefSeq) ywbC; hypothetical protein (A)
MAKRIDHTGIMVRDINASITFYEEVLGMKLKDRITHTNGVIELAFLGFEDGPETEIELIQ
GYSSELPAEGKVHHIALLTDDIAAEYTKAEKMNAKFIDEEITTLPNGYRYFYIEGPDGEW
IEFFQR

BLAST