GenomeNet

>bsu:BSU38820 no KO assigned | (RefSeq) yxkF; hypothetical protein (A)
MKSLLAIYPGSIVSEELCIREGCLCFFDESNQRYISIPKTEISEKEVLVLQSFLTPADEG
NQLSMKSPEENKWFSFLFSRGELPAYIKKRTRFVHFHLFGKIERTSFTEAVRHFWPVSFV
IVWIHEDRGVIVEQESEAAAEKDELESLAKVLESDFYFSVRFYAGRFYEPDECLRKHYAR
EQAYFLFAEKRLPQVQSVTFEMIFPFLLLETEKEKLETLLSEEAELLFGSESELRKTIKL
FIENNSNVTLTAKKLHLHRNSLQYRIDKFIERSGIDIKSYKGALLAYFICLQNESSE

BLAST