GenomeNet

>bsu:BSU39040 no KO assigned | (RefSeq) yxiS; hypothetical protein (A)
MNEKQLTEAYERDENMMILVFAQWCVNHDLDPMELYAKAYPQQKLNESLKKTMDDLVVPK
HEAEHIPDQTVIAVLEMFGNTDLAQALHEAISGRKQ

BLAST