GenomeNet

>bsu:BSU39280 no KO assigned | (RefSeq) yxxE; hypothetical protein (A)
MLLINKQKDPVFQFLAGTFHQDIETPDDAIQELLIEESKEYLEDAIVFLTDFIESEHSDN
KKNDYIQSCADGVYLPAFNLEPIDWLKNVIVQIKKSLKKFKR

BLAST