GenomeNet

>bsu:BSU39300 K21493 toxin YxiD [EC:3.1.-.-] | (RefSeq) yxiD; hypothetical protein (A)
MKTLDVHALHEGIQHTIEKLDKQKQQLEKLEKSVEHLAGMKDALKGKGGDAIRTFYEECH
KPFLLFFGIFIDEYKKVLKQTQHAISSVESNSHGMIAEAFLSHDARHGVKHAREVTEQLT
DAVNRQTSAIDHIVSLPTVNDSFFRMETEQAERLISDTLNKLFQFDGQQTQALEAAKSDF
QTMKKYIDQLETMYTGPKIEITGYKSGSILKSQEEENINQIFGAINPQMKQADDSPMEMM
LKKLAENEKSKVDSVVKTGDSKKVSKNIIVINGKVYNTSEHREHIKTDFSNAEVKQVVYN
DTLYNVYISGNDMKLEPVVSLSDIKVDENGYVKILETAVELTGVYDLFKAATGRDPVSGE
KVTGKDRVVASINSVPFAKIAKLEKLIDINKLINNGKKAKKASEVKNVAKDKGKIANDVS
GSANKINSDLIKKYARDIEQRTGRELPKNQIDKLKEALRNKEYKKMSPIETAKHRTKFDK
VKNKVIKEWEENTGQKWPVYKENVVSEKTGKIIRKKGDKYDAHHIIENTFGGEHEWWNMH
PAKFPNEHQAGIHGTGSPANELFKGGKKK

BLAST