GenomeNet

>bsu:BSU39450 no KO assigned | (RefSeq) yxeR; hypothetical protein (A)
MTVNDAVVFILAAFLLWGAADYCLGNRWGLGERFADGFKAMGPLALSMIGIVSLAPVLAA
ILIPIVAPFYTAIGADPSSFANTILAIDMGGYALAGEMAKDPQAGLFSWVFLGTMMGPAI
VFTIPVALGIIEKEDHPYFAKGILIGLCTVPIGCLIGGLCAGFDIGMIGKNLLIPSLLSA
VIAFGLWRYTDRMIQLFHLFGKAVSMVAIIGLAAVSVETMTGIVLIPGMENVETGIQTTG
TIAIALAGAFPMTAFITKTFKKPLQALGKCLHLDETATAGLVTSLAHHIPMLASLKDMTP
RGKVINVAFAVSGAFVLGSHLGFVAGMKKEMAAAMIIGKLAGGVTAAAAAAWMTPAQSAK
QQKRISASHS

BLAST