GenomeNet

>bsu:BSU39490 K16962 putative S-methylcysteine transport system permease protein | (RefSeq) yxeN; amino acid permease protein YxeN (A)
MNTIDWEFMISAFPTLIQALPITLFMAIAAMIFAIIGGLILALITKNKIPVLHQLSKLYI
SFFRGVPTLVQLFLIYYGLPQLFPEMSKMTALTAAIIGLSLKNAAYLAEIFRAALNSVDD
GQLEACLSVGMTKFQAYRRIILPQAIRNAIPATGNTFIGLLKETSLAFTLGVMEMFAQGK
MYASGNLKYFETYLAVAIVYWVLTIIYSILQDLFERAMSKPYRT

BLAST