GenomeNet

>bsu:BSU40530 K06329 spore coat protein F | (RefSeq) cotF; spore coat protein F (A)
MDERRTLAWHETLEMHELVAFQSNGLIKLKKMIREVKDPQLRQLYNVSIQGVEQNLRELL
PFFPQAPHREDEEEERADNPFYSGDLLGFAKTSVRSYAIAITETATPQLRNVLVKQLNAA
IQLHAQVYRYMYQHGYYPSYNLSELLKNDVRNANRAISMK

BLAST