GenomeNet

>bsu:BSU40600 no KO assigned | (RefSeq) yybL; hypothetical protein (A)
MKIKRLLLILCLLLFLVTLWFNQNHTYLGKNSIASLLYMNNSTFGYSSIFAYTLFYIVPF
LMLLSNFFHSENPYKVMRMVKRKNYYKSKIMEIGFVSLLFSSIHTVINITCTHIFFSKNL
LVEANFLSICLLNMISLVFFYLSVGIMFRLTYDLFNSVALAIFIVYIILDSLYFGVKLLL
PNGYWEPFRDLAIFTNMLNRYWSTSNLIIVYIRQIIIVFIFYLVGSSIFLNKDYKK

BLAST