GenomeNet

>bsu:BSU40630 no KO assigned | (RefSeq) yybI; hypothetical protein (A)
MNVYDIRMAPYWFYEGRGLVQHPYVFRQPVSSRAIIVSTRGDVTGDGVIDEVFLTGNQMP
GSPLWRNITLVIRDGRTHQEQRIQLQNNMGYNPSLFLGDMTGDKIEDVAVVMDTGGSGGA
IYAYVFAYLNRQFRRIFNSDVLNDELKYSVRYQNQYKASVISHQQNETYILDLTYKGREY
LNEIYNSQGVLKMPIEGWVNPLSGLYPVDFDRDGVYELLAYQRIAGRYNADSLGYVQTVL
KWNGQRFMFNRQTVTIFGSDLS

BLAST