GenomeNet

>bsu:BSU40640 no KO assigned | (RefSeq) yybH; hypothetical protein (A)
MEQQLKDIISACDLAIQNEDFDTLMNYYSEDAVLVVKPGMIARGKEEIKKAFITIANYFN
HHIVPTQGKMILLEAGDTVLVLSQTLLDSDKKDSEYAMERRATYVFKKNAQGEWLCVIDN
SYGTDLIGV

BLAST