GenomeNet

>bsu:BSU40700 no KO assigned | (RefSeq) yybB; hypothetical protein (A)
MNLRQLSEHVFQCEFELDVPLRIPVHTWFIKDGDDVYIVDTGIERFADAQIRAALAIGNP
KAILLTHGHSDHIGGASKWLERFDIPIFAHQKELKYINGEEPYPNKNEVENTGVAHIVQP
LTEQTLAHLPLKYYLTPGHSPGHVVYYHKIDRTLLTGDLFITSKEDLHPPIRRFSVDINE
NIDSGSIIDQIKPTLICSSHGEEILYNEELYKNYVVRYRD

BLAST