GenomeNet

>bsu:BSU40750 no KO assigned | (RefSeq) yyaQ; hypothetical protein (A)
MLTREDIFKHVKEKYGTSPDYPWEKYPNYASLRHTSNKKWYGLIMNVLPEKLGLDGHGEI
DILNLKCPPEISDRLRNGENILPGYHMDKEHWISIVLERTDPEGEIYNLIEQSFHLTK

BLAST