GenomeNet

>bsu:BSU40820 K06888 uncharacterized protein | (RefSeq) yyaL; hypothetical protein (A)
MPNKSKPNRLINEKSPYLLQHAHNPVDWFPWGEEAFEKAKRENKPVLVSIGYSTCHWCHV
MAHESFEDEEIARLLNERFVAIKVDREERPDVDSVYMRICQLMTGQGGWPLNVFITPDQK
PFYAGTYFPKTSKFNRPGFVDVLEHLSETFANDREHVEDIAENAAKHLQTKTAAKTGEGL
SESAIHRTFQQLASGFDTIYGGFGQAPKFPMPHMLMYLLRYDHNTGQENALYNVTKTLDS
MANGGIYDHIGYGFARYSTDDEWLVPHFEKMLYDNALLLTAYTEAYQVTQNSRYKEICEQ
IITFIQREMTHEDGSFFSALDADTEGEEGKYYVWSKEEILKTLGDDLGTLYCQVYDITEE
GNFEGKNIPNLIHTKREQIKEDAGLTEKELSLKLEDARQQLLKTREERTYPHVDDKVLTS
WNALMIAGLAKAAKVYQEPKYLSLAKDAITFIENKLIIDGRVMVRYRDGEVKNKGFIDDY
AFLLWAYLDLYEASFDLSYLQKAKKLTDDMISLFWDEEHGGFYFTGHDAEALIVREKEVY
DGAVPSGNSVAAVQLLRLGQVTGDLSLIEKAETMFSVFKPDIEAYPSGHAFFMQSVLRHL
MPKKEIVIFGSADDPARKQIIAELQKAFKPNDSILVAEQPEQCKDIAPFAADYRIIDGKT
TVYICENFACQQPTTNIEEAIHTLISSRD

BLAST