GenomeNet

>bsu:BSU40860 K01759 lactoylglutathione lyase [EC:4.4.1.5] | (RefSeq) yyaH; hypothetical protein (A)
MQIEHTAVWVNDLERMKSFYESYFNGEANDLYHNEKKDFKSYFITFDSGARLEIMKKGNV
TDPPSQTMTGWAHIAFSVGSREKVDELTDRLKADGFAVVNGPRTTGDGYYESVIEDDEGN
LIEITI

BLAST