GenomeNet

>bsu:BSU40890 K02963 small subunit ribosomal protein S18 | (RefSeq) rpsR; 30S ribosomal protein S18 (A)
MAGGRRGGRAKRRKVCYFTSNGITHIDYKDVDLLKKFVSERGKILPRRVTGTNAKYQRKL
TAAIKRARQMALLPYVSGE

BLAST