GenomeNet

>bsu:BSU40910 K02990 small subunit ribosomal protein S6 | (RefSeq) rpsF; 30S ribosomal protein S6 (A)
MRKYEVMYIIRPNIDEESKKAVIERFNNVLTSNGAEITGTKDWGKRRLAYEINDFRDGFY
QIVNVQSDAAAVQEFDRLAKISDDIIRHIVVKEEE

BLAST