GenomeNet

>bsu:BSU40950 no KO assigned | (RefSeq) yyaC; hypothetical protein (A)
MNRKGGLFSSQERVKQYVSHTDAAAAKQIQTILSSSLRKAAGKPIVVVCIGTDRSTGDSL
GPLVGMKLKQMQLTRFHVYGTLSDPVHAVNMKDKINDIHKLHKNPFVIAVDACLGRVKSV
GSFQIGDGPLKPGAGVQKDLPEVGDLHINGIVNVSGFMEYFVLQNTRLNLVMNMANVLAE
GLSLTDRTEWRQERLNPLQRLTGRI

BLAST