GenomeNet

>bsu:BSU41000 K03501 16S rRNA (guanine527-N7)-methyltransferase [EC:2.1.1.170] | (RefSeq) gidB; ribosomal RNA small subunit methyltransferase G (A)
MNIEEFTSGLAEKGISLSPRQLEQFELYYDMLVEWNEKINLTSITEKKEVYLKHFYDSIT
AAFYVDFNQVNTICDVGAGAGFPSLPIKICFPHLHVTIVDSLNKRITFLEKLSEALQLEN
TTFCHDRAETFGQRKDVRESYDIVTARAVARLSVLSELCLPLVKKNGLFVALKAASAEEE
LNAGKKAITTLGGELENIHSFKLPIEESDRNIMVIRKIKNTPKKYPRKPGTPNKSPIEG

BLAST