GenomeNet

>bsu:BSU41010 K03495 tRNA uridine 5-carboxymethylaminomethyl modification enzyme | (RefSeq) gidA; tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG (A)
MGYEAGQYDVIVIGAGHAGVEAALASARQGAKTLVLTINLDMVAFMPCNPSVGGPAKGIV
VREIDALGGEMGRNIDKTHIQMRMLNTGKGPAVRALRAQADKFQYQHEMKNTLEKEPNLT
LLQGIVERLIVEDGECRGVITQTGAHYRAKAVVMTTGTYLRGRIILGDLSYSSGPNNQQP
SIKLSEHLEELGFDLVRFKTGTPPRVKSDTIDYSKTEIQPGDDVPRAFSYETVEYITDQL
PCWLTYTSPETHEIIDSNLHRSPMYSGMIKGTGPRYCPSIEDKVVRFNDKPRHQIFLEPE
GRNTQEVYVQGLSTSLPEDVQQRMLATIPGLENVQMMRAGYAIEYDAIVPTQLWPTLETK
KITNLYTAGQINGTSGYEEAAGQGIMAGINAGRKALGKEEVILSRSDAYIGVLIDDLVTK
GTNEPYRLLTSRAEYRLLLRHDNADLRLTEIGHRIGLISDERYAAFEKKKAAIEAEKKRL
HSVIIKPSPENQEYIRSLGGSELKDGVRGTDLMKRPEMNYETVTKLAPPEVPVPQDVAEQ
VEIQVKYEGYIEKSLQQVEKLKKMENKKIPDRIDYDAIKGIATEARQKLKNVRPLSVAQA
SRISGVNPADISILLVYLEQGRIAKIAE

BLAST