GenomeNet

>bsu:BSU41060 K02914 large subunit ribosomal protein L34 | (RefSeq) rpmH; 50S ribosomal protein L34 (A)
MKRTFQPNNRKRSKVHGFRSRMSSKNGRLVLARRRRKGRKVLSA

BLAST