GenomeNet

>bta:516210 K00933 creatine kinase [EC:2.7.3.2] | (RefSeq) CKB; creatine kinase B-type (A)
MPFSNSHNTLKLRFPAEDEFPDLSGHNNHMAKVLTPELYAELRAKSTPSGFTVDDVIQTG
VDNPGHPYIMTVGCVAGDEESYDVFKELFDPIIEDRHGGYKPTDEHKTDLNPDNLQGGDD
LDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMT
EAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWINEEDHLRVISM
QKGGNMKEVFTRFCNGLTQIETLFKSKNYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLP
HLGKHEKFPEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLL
IEMEQRLEQGQAIDDLMPAQK

BLAST