GenomeNet

>bta:525738 K01245 ADP-ribosylarginine hydrolase [EC:3.2.2.19] | (RefSeq) ADPRH; [Protein ADP-ribosylarginine] hydrolase (A)
MCGALMERYVAAMVLSAAGDALGYFNGKWEFLQNGEKIHRQLAQLGGLDAIDVERWRVSD
DTVMHLATAEALLEAGKVSDLTHLYSLLAKHYQDCMGDMDGRAPGGASVQNAMLLEPDKA
DGWRIPFNSHEGGCGAAMRAMCIGLRFPHSSQLDSLIQVSIESGRMTHHHPTGYLGALVS
ALFTAYAVNGKPPQQWGRGLMEVLPEAKKYIVQSGFFVEQNLQHWSYFQDQWEKYLKLRG
IWDGKSAPTFPKPFDVKERDQFYSSVSYSGWGGSSGHDAPMIAYDAILAAGDSWKELAHR
AFFHGGDSDSTAAIAGCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLR

BLAST