GenomeNet

>bter:100651072 K01158 deoxyribonuclease II [EC:3.1.22.1] | (RefSeq) plancitoxin-1 isoform X1 (A)
MKQKIENMKVIFYATTLIIASNVICGARYNKLQCKDEKDVPVDWYVLYKLPKVHTSSNPL
IREGIAYLYITNATIETGWQVSSRPIGSNNSIPGITLAPLYNQDNKNESIWSLYNDSPPN
SSYAWSFGHTKGVVMANSDQGFWLIHSVPNFPPVPKSGVQTRRLKRENITADGKYSYPVS
GTFYGQSFLCISLGSDQFDIIGEQLIYNEIAVYAKNIPDILGKQYPVLKNAINQKHIKTP
PYNHKAVIRSLRMIEFISFAKDGKWGKDLYGDFVAPQLQTDLYVQSWLNGRGKLPSICTR
RKIYNVKSFEFDVANVNFASSQDHSKWAITDTKKSANRWVCIGDINRADTQYSRGGGIVC
FKEARLWTDYRNIINDVEPCNHT

BLAST